Lineage for d5eckb1 (5eck B:4-83)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135064Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (16 PDB entries)
  8. 2135066Domain d5eckb1: 5eck B:4-83 [324620]
    Other proteins in same PDB: d5eckb2, d5eckc2, d5ecke2, d5eckf2
    automated match to d3fhsa3
    complexed with atp, gsh, ile, jaa

Details for d5eckb1

PDB Entry: 5eck (more details), 1.54 Å

PDB Description: crystal structure of fin219-fip1 complex with ja, ile and atp
PDB Compounds: (B:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5eckb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eckb1 c.47.1.0 (B:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
vceslnvvqyvdeawpeknp

SCOPe Domain Coordinates for d5eckb1:

Click to download the PDB-style file with coordinates for d5eckb1.
(The format of our PDB-style files is described here.)

Timeline for d5eckb1: