Lineage for d5ecie2 (5eci E:84-217)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327394Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)
  8. 2327405Domain d5ecie2: 5eci E:84-217 [324619]
    Other proteins in same PDB: d5ecib1, d5ecic1, d5ecie1, d5ecif1
    automated match to d2vo4a2
    complexed with atp, gsh, jaa, mg

Details for d5ecie2

PDB Entry: 5eci (more details), 1.56 Å

PDB Description: crystal structure of fin219-fip1 complex with ja, atp and mg
PDB Compounds: (E:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ecie2 a.45.1.0 (E:84-217) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl

SCOPe Domain Coordinates for d5ecie2:

Click to download the PDB-style file with coordinates for d5ecie2.
(The format of our PDB-style files is described here.)

Timeline for d5ecie2: