Lineage for d5eclf2 (5ecl F:84-217)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 1999735Species Arabidopsis thaliana [TaxId:3702] [324612] (13 PDB entries)
  8. 1999774Domain d5eclf2: 5ecl F:84-217 [324613]
    Other proteins in same PDB: d5eclb1, d5eclc1, d5ecle1, d5eclf1
    automated match to d2vo4a2
    complexed with gsh, ile, jaa, mg

Details for d5eclf2

PDB Entry: 5ecl (more details), 1.85 Å

PDB Description: crystal structure of fin219-fip1 complex with ja, ile and mg
PDB Compounds: (F:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5eclf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eclf2 a.45.1.0 (F:84-217) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl

SCOPe Domain Coordinates for d5eclf2:

Click to download the PDB-style file with coordinates for d5eclf2.
(The format of our PDB-style files is described here.)

Timeline for d5eclf2: