SCOPe 2.08: Domain d5djla2: 5djl A:77-209

Lineage for d5djla2 (5djl A:77-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries)

8. Domain d5djla2: 5djl A:77-209 [324610]
   Other proteins in same PDB: d5djla1, d5djlb1
   automated match to d13gsa1
   complexed with ca, co3, gsh, mes, pt, so4

Details for d5djla2

PDB Entry: 5djl, 1.8 Å

PDB Description: structure of wt human glutathione transferase in complex with cisplatin in the presence of glutathione.

PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5djla2:

Sequence; same for both SEQRES and ATOM records:

>d5djla2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d5djla2:

• d5djla2 first appeared in SCOPe 2.06
  
• d5djla2 appears in SCOPe 2.07