Lineage for d5djlb2 (5djl B:77-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 2322238Protein Class pi GST [81347] (4 species)
  7. 2322239Species Human (Homo sapiens) [TaxId:9606] [47619] (64 PDB entries)
  8. 2322325Domain d5djlb2: 5djl B:77-209 [324609]
    Other proteins in same PDB: d5djla1, d5djlb1
    automated match to d13gsa1
    complexed with ca, co3, gsh, mes, pt, so4

Details for d5djlb2

PDB Entry: 5djl (more details), 1.8 Å

PDB Description: structure of wt human glutathione transferase in complex with cisplatin in the presence of glutathione.
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d5djlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5djlb2 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5djlb2:

Click to download the PDB-style file with coordinates for d5djlb2.
(The format of our PDB-style files is described here.)

Timeline for d5djlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5djlb1