SCOPe 2.08: Domain d5swce1: 5swc E:1-220

Lineage for d5swce1 (5swc E:1-220)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (15 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [324578] (1 PDB entry)

8. Domain d5swce1: 5swc E:1-220 [324596]
   Other proteins in same PDB: d5swca2, d5swcb2, d5swcc2, d5swcd2, d5swce2, d5swcf2
   automated match to d4rxya_
   complexed with cl, fmt, zn

Details for d5swce1

PDB Entry: 5swc, 1.45 Å

PDB Description: the structure of the beta-carbonic anhydrase ccaa

PDB Compounds: (E:) carbonic anhydrase

SCOPe Domain Sequences for d5swce1:

Sequence; same for both SEQRES and ATOM records:

>d5swce1 c.53.2.0 (E:1-220) automated matches {Synechocystis sp. [TaxId: 1111708]}
mqrlieglqkfregyfsshrdlfeqlshgqhprilficcsdsrvdpnlitqsevgdlfvi
rnagniippygaanggegaameyalvaleinqiivcghshcgamkgllklnslqeklplv
ydwlkhteatrrlvldnyshlegedlievavaeniltqlknlqtypaihsrlhrgdlslh
gwiyrieegevlaydgvlhdfvapqsrinalepedeyalh

Timeline for d5swce1:

• d5swce1 first appeared in SCOPe 2.06
  
• d5swce1 appears in SCOPe 2.07