Lineage for d5syma_ (5sym A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902236Domain d5syma_: 5sym A: [324593]
    automated match to d3u0va_
    complexed with 71q, cl, edo

Details for d5syma_

PDB Entry: 5sym (more details), 1.55 Å

PDB Description: cocrystal structure of the human acyl protein thioesterase 1 with an isoform-selective inhibitor, ml348
PDB Compounds: (A:) Acyl-protein thioesterase 1

SCOPe Domain Sequences for d5syma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5syma_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrpvtlnmnv
ampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsqggalsly
talttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplmfgsltve
klktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppid

SCOPe Domain Coordinates for d5syma_:

Click to download the PDB-style file with coordinates for d5syma_.
(The format of our PDB-style files is described here.)

Timeline for d5syma_: