SCOPe 2.08: Domain d5t47c1: 5t47 C:69-248

Lineage for d5t47c1 (5t47 C:69-248)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)

8. Domain d5t47c1: 5t47 C:69-248 [324588]
   Other proteins in same PDB: d5t47a2, d5t47c2
   automated match to d1ipca_
   complexed with gol

Details for d5t47c1

PDB Entry: 5t47, 2.2 Å

PDB Description: crystal structure of the d. melanogaster eif4e-eif4g complex

PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5t47c1:

Sequence, based on SEQRES records:

>d5t47c1 d.86.1.0 (C:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl

Sequence, based on observed residues (ATOM records):

>d5t47c1 d.86.1.0 (C:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgnslqyqlhkdsiytl

Timeline for d5t47c1:

• d5t47c1 first appeared in SCOPe 2.06
  
• d5t47c1 appears in SCOPe 2.07