Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
Protein automated matches [190708] (10 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries) |
Domain d5t47c1: 5t47 C:69-248 [324588] Other proteins in same PDB: d5t47a2, d5t47c2 automated match to d1ipca_ complexed with gol |
PDB Entry: 5t47 (more details), 2.2 Å
SCOPe Domain Sequences for d5t47c1:
Sequence, based on SEQRES records: (download)
>d5t47c1 d.86.1.0 (C:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl
>d5t47c1 d.86.1.0 (C:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir gksnkisiwtadgnneeaaleighklrdalrlgnslqyqlhkdsiytl
Timeline for d5t47c1: