SCOPe 2.06: Domain d5sync_: 5syn C:

Lineage for d5sync_ (5syn C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)

8. Domain d5sync_: 5syn C: [324584]
   automated match to d3cn9a_
   complexed with 71t, edo

Details for d5sync_

PDB Entry: 5syn, 1.64 Å

PDB Description: cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349

PDB Compounds: (C:) Acyl-protein thioesterase 2

SCOPe Domain Sequences for d5sync_:

Sequence, based on SEQRES records:

>d5sync_ c.69.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
ytaltcphplagivalscwlplhrafpqaangsakdlailqchgeldpmvpvrfgaltae
klrsvvtparvqfktypgvmhsscpqemaavkeflekllppv

Sequence, based on observed residues (ATOM records):

>d5sync_ c.69.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lltdaatvsgaeretaaviflhglgdtghswadalstirlphvkyicphapripvtlnmk
mvmpswfdlmglspdapedeagikkaaenikaliehemkngipanrivlggfsqggalsl
ytaltcphplagivalscwlplhrafpqangsakdlailqchgeldpmvpvrfgaltaek
lrsvvtparvqfktypgvmhsscpqemaavkeflekllppv

Timeline for d5sync_:

• d5sync_ is new in SCOPe 2.06-stable
  
• d5sync_ appears in SCOPe 2.07
  
• d5sync_ appears in the current release, SCOPe 2.08