![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Tyrosine-protein kinase SYK [118131] (1 species) PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries) Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576) |
![]() | Domain d5t68a1: 5t68 A:363-635 [324581] Other proteins in same PDB: d5t68a2 automated match to d3tuca_ complexed with 77v |
PDB Entry: 5t68 (more details), 2.93 Å
SCOPe Domain Sequences for d5t68a1:
Sequence, based on SEQRES records: (download)
>d5t68a1 d.144.1.7 (A:363-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy dlmnlcwtydvenrpgfaavelrlrnyyydvvn
>d5t68a1 d.144.1.7 (A:363-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee snfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfss ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty dvenrpgfaavelrlrnyyydvvn
Timeline for d5t68a1: