Lineage for d1g3it_ (1g3i T:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23655Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 protein domains)
  6. 23692Protein HslU [52721] (2 species)
  7. 23712Species Haemophilus influenzae [TaxId:727] [52723] (2 PDB entries)
  8. 23721Domain d1g3it_: 1g3i T: [32458]
    Other proteins in same PDB: d1g3ig_, d1g3ih_, d1g3ii_, d1g3ij_, d1g3ik_, d1g3il_, d1g3im_, d1g3in_, d1g3io_, d1g3ip_, d1g3iq_, d1g3ir_

Details for d1g3it_

PDB Entry: 1g3i (more details), 3.41 Å

PDB Description: crystal structure of the hsluv protease-chaperone complex

SCOP Domain Sequences for d1g3it_:

Sequence, based on SEQRES records: (download)

>d1g3it_ c.37.1.13 (T:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1g3it_ c.37.1.13 (T:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknraraedvaeidde
aaklinpeelkqkaidaveqngivfideidkickksgadvsregvqrdllplvegstvst
khgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslt
eqykalmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasd
mngqtvnidaayvadalgevvenedlsrfil

SCOP Domain Coordinates for d1g3it_:

Click to download the PDB-style file with coordinates for d1g3it_.
(The format of our PDB-style files is described here.)

Timeline for d1g3it_: