Lineage for d5t68b_ (5t68 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983145Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983146Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2983230Domain d5t68b_: 5t68 B: [324571]
    Other proteins in same PDB: d5t68a2
    automated match to d3tuca_
    complexed with 77v

Details for d5t68b_

PDB Entry: 5t68 (more details), 2.93 Å

PDB Description: crystal structure of syk catalytic domain in complex with a furo[3,2- d]pyrimidine
PDB Compounds: (B:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d5t68b_:

Sequence, based on SEQRES records: (download)

>d5t68b_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvn

Sequence, based on observed residues (ATOM records): (download)

>d5t68b_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
snfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfss
ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
dvenrpgfaavelrlrnyyydvvn

SCOPe Domain Coordinates for d5t68b_:

Click to download the PDB-style file with coordinates for d5t68b_.
(The format of our PDB-style files is described here.)

Timeline for d5t68b_: