Lineage for d1g3id_ (1g3i D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180232Protein HslU [52721] (2 species)
  7. 180262Species Haemophilus influenzae [TaxId:727] [52723] (4 PDB entries)
  8. 180280Domain d1g3id_: 1g3i D: [32454]
    Other proteins in same PDB: d1g3ig_, d1g3ih_, d1g3ii_, d1g3ij_, d1g3ik_, d1g3il_, d1g3im_, d1g3in_, d1g3io_, d1g3ip_, d1g3iq_, d1g3ir_

Details for d1g3id_

PDB Entry: 1g3i (more details), 3.41 Å

PDB Description: crystal structure of the hsluv protease-chaperone complex
PDB Compounds: (D:)

SCOP Domain Sequences for d1g3id_:

Sequence, based on SEQRES records: (download)

>d1g3id_ c.37.1.13 (D:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1g3id_ c.37.1.13 (D:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknranpeelkq
kaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhilfi
asgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvn
iafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayv
adalgevvenedlsrfil

SCOP Domain Coordinates for d1g3id_:

Click to download the PDB-style file with coordinates for d1g3id_.
(The format of our PDB-style files is described here.)

Timeline for d1g3id_: