Lineage for d5j9we_ (5j9w E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209547Protein automated matches [190241] (12 species)
    not a true protein
  7. 2209600Species Saccharomyces cerevisiae [TaxId:559292] [324445] (3 PDB entries)
  8. 2209605Domain d5j9we_: 5j9w E: [324515]
    automated match to d3to9a_
    complexed with aco

Details for d5j9we_

PDB Entry: 5j9w (more details), 2.8 Å

PDB Description: crystal structure of the nua4 core complex
PDB Compounds: (E:) Histone acetyltransferase ESA1

SCOPe Domain Sequences for d5j9we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j9we_ d.108.1.1 (E:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqk
plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
qhiiflnedildrynrlkakkrrtidpnrliwkppvft

SCOPe Domain Coordinates for d5j9we_:

Click to download the PDB-style file with coordinates for d5j9we_.
(The format of our PDB-style files is described here.)

Timeline for d5j9we_: