![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:1639] [324509] (1 PDB entry) |
![]() | Domain d5loqb_: 5loq B: [324513] automated match to d1vdha_ complexed with fec, mpd, na |
PDB Entry: 5loq (more details), 1.69 Å
SCOPe Domain Sequences for d5loqb_:
Sequence, based on SEQRES records: (download)
>d5loqb_ d.58.4.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]} ktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysilg qkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmaggddpy qnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkv qqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseql sklfti
>d5loqb_ d.58.4.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]} ktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysilg qkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsyqnkgvrarlypal ppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsigfddy ewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti
Timeline for d5loqb_:
![]() Domains from other chains: (mouse over for more information) d5loqa_, d5loqc_, d5loqd_, d5loqe_ |