Lineage for d1g41a_ (1g41 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122636Protein HslU [52721] (2 species)
  7. 122666Species Haemophilus influenzae [TaxId:727] [52723] (3 PDB entries)
  8. 122667Domain d1g41a_: 1g41 A: [32450]

Details for d1g41a_

PDB Entry: 1g41 (more details), 2.3 Å

PDB Description: crystal structure of hslu haemophilus influenzae
PDB Compounds: (A:)

SCOP Domain Sequences for d1g41a_:

Sequence, based on SEQRES records: (download)

>d1g41a_ c.37.1.13 (A:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
daayvadalgevvenedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1g41a_ c.37.1.13 (A:) HslU {Haemophilus influenzae}
semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftvgkevdsiirdltdsamklvrqqeiaknrlidde
aaklinpeelkqkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegst
vstkhgmvktdhilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltepha
slteqykalmategvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfs
asdmngqtvnidaayvadalgevvenedlsrfil

SCOP Domain Coordinates for d1g41a_:

Click to download the PDB-style file with coordinates for d1g41a_.
(The format of our PDB-style files is described here.)

Timeline for d1g41a_: