SCOPe 2.08: Domain d5gj4e1: 5gj4 E:49-87

Lineage for d5gj4e1 (5gj4 E:49-87)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus (strain mr 766) [TaxId:64320] [324387] (1 PDB entry)

8. Domain d5gj4e1: 5gj4 E:49-87 [324495]
   Other proteins in same PDB: d5gj4b_, d5gj4d_, d5gj4f_, d5gj4h_
   automated match to d2ijoa_
   complexed with cl

Details for d5gj4e1

PDB Entry: 5gj4, 1.84 Å

PDB Description: structure of ns2b-ns3 protease from zika virus caught after self- cleavage

PDB Compounds: (E:) Serine protease subunit NS2B

SCOPe Domain Sequences for d5gj4e1:

Sequence; same for both SEQRES and ATOM records:

>d5gj4e1 g.96.1.0 (E:49-87) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
vdmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d5gj4e1:

• d5gj4e1 first appeared in SCOPe 2.06
  
• d5gj4e1 appears in SCOPe 2.07