Lineage for d5i4zb_ (5i4z B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709988Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 2709989Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 2710047Family a.38.1.0: automated matches [324429] (1 protein)
    not a true family
  6. 2710048Protein automated matches [324430] (1 species)
    not a true protein
  7. 2710049Species Human (Homo sapiens) [TaxId:9606] [324431] (4 PDB entries)
  8. 2710053Domain d5i4zb_: 5i4z B: [324470]
    automated match to d1nkpb_
    complexed with cl, gol, k

Details for d5i4zb_

PDB Entry: 5i4z (more details), 1.95 Å

PDB Description: structure of apo omomyc
PDB Compounds: (B:) myc proto-oncogene protein

SCOPe Domain Sequences for d5i4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4zb_ a.38.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrnelkrsffalrdqipelennekapkvvilkkatayilsvqaetqkliseidllrkqne
qlkhkleqlrnsca

SCOPe Domain Coordinates for d5i4zb_:

Click to download the PDB-style file with coordinates for d5i4zb_.
(The format of our PDB-style files is described here.)

Timeline for d5i4zb_: