Lineage for d1g4bf_ (1g4b F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113456Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 protein domains)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2113595Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 2113596Species Escherichia coli [TaxId:562] [52722] (11 PDB entries)
  8. 2113626Domain d1g4bf_: 1g4b F: [32447]
    Other proteins in same PDB: d1g4bm_, d1g4bn_, d1g4bo_, d1g4bp_

Details for d1g4bf_

PDB Entry: 1g4b (more details), 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism
PDB Compounds: (F:) ATP-dependent hsl protease ATP-binding subunit hslu

SCOPe Domain Sequences for d1g4bf_:

Sequence, based on SEQRES records: (download)

>d1g4bf_ c.37.1.20 (F:) HslU {Escherichia coli [TaxId: 562]}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
adyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1g4bf_ c.37.1.20 (F:) HslU {Escherichia coli [TaxId: 562]}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklreglkikdamkllieeea
aklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctv
stkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnas
itvqykalmategvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisyda
sdlsgqnitidadyvskhldalvadedlsrfil

SCOPe Domain Coordinates for d1g4bf_:

Click to download the PDB-style file with coordinates for d1g4bf_.
(The format of our PDB-style files is described here.)

Timeline for d1g4bf_: