Lineage for d5ehga1 (5ehg A:7-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894568Species Dengue virus type 3 (strain philippines/h87/1956) [TaxId:408870] [324373] (4 PDB entries)
  8. 2894575Domain d5ehga1: 5ehg A:7-256 [324464]
    Other proteins in same PDB: d5ehga2, d5ehgc2
    automated match to d3elda_
    complexed with 5o0, sam

Details for d5ehga1

PDB Entry: 5ehg (more details), 2.02 Å

PDB Description: dengue 3 ns5 methyltransferase bound to s-adenosyl methionine and molecule bf341
PDB Compounds: (A:) RNA-directed RNA polymerase NS5

SCOPe Domain Sequences for d5ehga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ehga1 c.66.1.0 (A:7-256) automated matches {Dengue virus type 3 (strain philippines/h87/1956) [TaxId: 408870]}
etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv
ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl
msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym
ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth
rrptiekdvd

SCOPe Domain Coordinates for d5ehga1:

Click to download the PDB-style file with coordinates for d5ehga1.
(The format of our PDB-style files is described here.)

Timeline for d5ehga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ehga2