SCOPe 2.07: Domain d5b8cc1: 5b8c C:32-146

Lineage for d5b8cc1 (5b8c C:32-146)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (9 PDB entries)

8. Domain d5b8cc1: 5b8c C:32-146 [324456]
   Other proteins in same PDB: d5b8ca_, d5b8cb_, d5b8cc2, d5b8cd_, d5b8ce_, d5b8cf2, d5b8cg_, d5b8ch_, d5b8ci2, d5b8cj_, d5b8ck_, d5b8cl2
   automated match to d3bikc_

Details for d5b8cc1

PDB Entry: 5b8c, 2.15 Å

PDB Description: high resolution structure of the human pd-1 in complex with pembrolizumab fv

PDB Compounds: (C:) Programmed cell death protein 1

SCOPe Domain Sequences for d5b8cc1:

Sequence; same for both SEQRES and ATOM records:

>d5b8cc1 b.1.1.1 (C:32-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq
dsrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

Timeline for d5b8cc1:

• d5b8cc1 first appeared in SCOPe 2.06
  
• d5b8cc1 appears in the current release, SCOPe 2.08