Lineage for d5b8cc1 (5b8c C:32-146)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2346944Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 2346945Species Human (Homo sapiens) [TaxId:9606] [256383] (6 PDB entries)
  8. 2346946Domain d5b8cc1: 5b8c C:32-146 [324456]
    Other proteins in same PDB: d5b8ca_, d5b8cb_, d5b8cc2, d5b8cd_, d5b8ce_, d5b8cf2, d5b8cg_, d5b8ch_, d5b8ci2, d5b8cj_, d5b8ck_, d5b8cl2
    automated match to d3bikc_

Details for d5b8cc1

PDB Entry: 5b8c (more details), 2.15 Å

PDB Description: high resolution structure of the human pd-1 in complex with pembrolizumab fv
PDB Compounds: (C:) Programmed cell death protein 1

SCOPe Domain Sequences for d5b8cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b8cc1 b.1.1.1 (C:32-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq
dsrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte

SCOPe Domain Coordinates for d5b8cc1:

Click to download the PDB-style file with coordinates for d5b8cc1.
(The format of our PDB-style files is described here.)

Timeline for d5b8cc1: