Lineage for d5fd0a1 (5fd0 A:8-150)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571710Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 2571749Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species)
  7. 2571750Species Streptomyces plicatus [TaxId:1922] [64344] (8 PDB entries)
  8. 2571757Domain d5fd0a1: 5fd0 A:8-150 [324454]
    Other proteins in same PDB: d5fd0a2
    automated match to d1jaka2
    complexed with gol, nag, so4

Details for d5fd0a1

PDB Entry: 5fd0 (more details), 2 Å

PDB Description: streptomyces plicatus n-acetyl-beta-hexosaminidase in complex with naglucal
PDB Compounds: (A:) B-N-acetylhexosaminidase

SCOPe Domain Sequences for d5fd0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fd0a1 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus [TaxId: 1922]}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr

SCOPe Domain Coordinates for d5fd0a1:

Click to download the PDB-style file with coordinates for d5fd0a1.
(The format of our PDB-style files is described here.)

Timeline for d5fd0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fd0a2