SCOPe 2.06: Domain d5fd0a1: 5fd0 A:8-150

Lineage for d5fd0a1 (5fd0 A:8-150)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species)

7. Species Streptomyces plicatus [TaxId:1922] [64344] (8 PDB entries)

8. Domain d5fd0a1: 5fd0 A:8-150 [324454]
   Other proteins in same PDB: d5fd0a2
   automated match to d1jaka2
   complexed with gol, nag, so4

Details for d5fd0a1

PDB Entry: 5fd0, 2 Å

PDB Description: streptomyces plicatus n-acetyl-beta-hexosaminidase in complex with naglucal

PDB Compounds: (A:) B-N-acetylhexosaminidase

SCOPe Domain Sequences for d5fd0a1:

Sequence; same for both SEQRES and ATOM records:

>d5fd0a1 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus [TaxId: 1922]}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr

Timeline for d5fd0a1:

• d5fd0a1 is new in SCOPe 2.06-stable
  
• d5fd0a1 appears in SCOPe 2.07
  
• d5fd0a1 appears in the current release, SCOPe 2.08