SCOPe 2.07: Domain d5f5qb_: 5f5q B:

Lineage for d5f5qb_ (5f5q B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Canavalia cathartica [TaxId:28958] [324440] (1 PDB entry)

8. Domain d5f5qb_: 5f5q B: [324447]
   automated match to d2p2ka_
   complexed with ca, mma, mn

Details for d5f5qb_

PDB Entry: 5f5q, 2.52 Å

PDB Description: crystal structure of canavalia virosa lectin in complex with alpha- methyl-mannoside

PDB Compounds: (B:) Concanavalin-A

SCOPe Domain Sequences for d5f5qb_:

Sequence; same for both SEQRES and ATOM records:

>d5f5qb_ b.29.1.1 (B:) automated matches {Canavalia cathartica [TaxId: 28958]}
dtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkrl
savvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsth
etnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhi
wessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d5f5qb_:

• d5f5qb_ first appeared in SCOPe 2.06
  
• d5f5qb_ appears in the current release, SCOPe 2.08