Lineage for d5f5qb_ (5f5q B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778953Species Canavalia cathartica [TaxId:28958] [324440] (1 PDB entry)
  8. 2778955Domain d5f5qb_: 5f5q B: [324447]
    automated match to d2p2ka_
    complexed with ca, mma, mn

Details for d5f5qb_

PDB Entry: 5f5q (more details), 2.52 Å

PDB Description: crystal structure of canavalia virosa lectin in complex with alpha- methyl-mannoside
PDB Compounds: (B:) Concanavalin-A

SCOPe Domain Sequences for d5f5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f5qb_ b.29.1.1 (B:) automated matches {Canavalia cathartica [TaxId: 28958]}
dtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkrl
savvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsth
etnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhi
wessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d5f5qb_:

Click to download the PDB-style file with coordinates for d5f5qb_.
(The format of our PDB-style files is described here.)

Timeline for d5f5qb_: