| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein automated matches [190035] (28 species) not a true protein |
| Species Canavalia cathartica [TaxId:28958] [324440] (1 PDB entry) |
| Domain d5f5qb_: 5f5q B: [324447] automated match to d2p2ka_ complexed with ca, mma, mn |
PDB Entry: 5f5q (more details), 2.52 Å
SCOPe Domain Sequences for d5f5qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f5qb_ b.29.1.1 (B:) automated matches {Canavalia cathartica [TaxId: 28958]}
dtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkrl
savvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnsth
etnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhi
wessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d5f5qb_: