Lineage for d5b3xa_ (5b3x A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162128Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2162135Species Escherichia coli K-12 [TaxId:83333] [159806] (11 PDB entries)
  8. 2162146Domain d5b3xa_: 5b3x A: [324439]
    automated match to d3vfja_
    complexed with mal

Details for d5b3xa_

PDB Entry: 5b3x (more details), 2.4 Å

PDB Description: crystal structure of hpin1 ww domain (5-15) fused with maltose-binding protein in p41212 form
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1,Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5b3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3xa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]}
lppgwekrmgsgkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfp
qvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypi
avealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggya
fkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamting
pwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltde
gleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavi
naasgrqtvdealkdaq

SCOPe Domain Coordinates for d5b3xa_:

Click to download the PDB-style file with coordinates for d5b3xa_.
(The format of our PDB-style files is described here.)

Timeline for d5b3xa_: