SCOPe 2.08: Domain d5eeda_: 5eed A:

Lineage for d5eeda_ (5eed A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [237679] (4 PDB entries)

8. Domain d5eeda_: 5eed A: [324435]
   automated match to d4ck4b_
   complexed with de1

Details for d5eeda_

PDB Entry: 5eed, 2 Å

PDB Description: ovine lactoglobulin complex with decanol

PDB Compounds: (A:) Beta-lactoglobulin-1/B

SCOPe Domain Sequences for d5eeda_:

Sequence; same for both SEQRES and ATOM records:

>d5eeda_ b.60.1.1 (A:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdnealekfdkalkalpmhirlafnptqlegqchv

Timeline for d5eeda_:

• d5eeda_ first appeared in SCOPe 2.06
  
• d5eeda_ appears in SCOPe 2.07