SCOPe 2.08: Domain d5i4za_: 5i4z A:

Lineage for d5i4za_ (5i4z A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.0: automated matches [324429] (1 protein)
   not a true family

6. Protein automated matches [324430] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [324431] (4 PDB entries)

8. Domain d5i4za_: 5i4z A: [324432]
   automated match to d1nkpb_
   complexed with cl, gol, k

Details for d5i4za_

PDB Entry: 5i4z, 1.95 Å

PDB Description: structure of apo omomyc

PDB Compounds: (A:) myc proto-oncogene protein

SCOPe Domain Sequences for d5i4za_:

Sequence; same for both SEQRES and ATOM records:

>d5i4za_ a.38.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrnelkrsffalrdqipelennekapkvvilkkatayilsvqaetqkliseidllrkqne
qlkhkleqlrnsca

Timeline for d5i4za_:

• d5i4za_ first appeared in SCOPe 2.06
  
• d5i4za_ appears in SCOPe 2.07