Lineage for d1e94f_ (1e94 F:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 832094Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 832226Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 832227Species Escherichia coli [TaxId:562] [52722] (9 PDB entries)
  8. 832229Domain d1e94f_: 1e94 F: [32443]
    Other proteins in same PDB: d1e94a_, d1e94b_, d1e94c_, d1e94d_
    complexed with anp

Details for d1e94f_

PDB Entry: 1e94 (more details), 2.8 Å

PDB Description: hslv-hslu from e.coli
PDB Compounds: (F:) heat shock protein hslu

SCOP Domain Sequences for d1e94f_:

Sequence, based on SEQRES records: (download)

>d1e94f_ c.37.1.20 (F:) HslU {Escherichia coli [TaxId: 562]}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1e94f_ c.37.1.20 (F:) HslU {Escherichia coli [TaxId: 562]}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieikqkar
klkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsr
egvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqa
lttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarr
lhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil

SCOP Domain Coordinates for d1e94f_:

Click to download the PDB-style file with coordinates for d1e94f_.
(The format of our PDB-style files is described here.)

Timeline for d1e94f_: