Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (12 species) not a true protein |
Species Zika virus (strain mr 766) [TaxId:64320] [324405] (8 PDB entries) |
Domain d5gj4f_: 5gj4 F: [324428] Other proteins in same PDB: d5gj4a1, d5gj4c1, d5gj4e1, d5gj4g1 automated match to d3e90d_ complexed with cl |
PDB Entry: 5gj4 (more details), 1.84 Å
SCOPe Domain Sequences for d5gj4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gj4f_ b.47.1.3 (F:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]} tdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvs ycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgsp ildkcgrviglygngvvikngsyvsaitqgkr
Timeline for d5gj4f_: