SCOPe 2.08: Domain d5fcta_: 5fct A:

Lineage for d5fcta_ (5fct A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)

8. Domain d5fcta_: 5fct A: [324421]
   automated match to d4eb4a_
   complexed with c2f, ufp

Details for d5fcta_

PDB Entry: 5fct, 1.55 Å

PDB Description: mouse thymidylate synthase in ternary complex with fdump and methylenetetrahydrofolate.

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d5fcta_:

Sequence; same for both SEQRES and ATOM records:

>d5fcta_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

Timeline for d5fcta_:

• d5fcta_ first appeared in SCOPe 2.06
  
• d5fcta_ appears in SCOPe 2.07