Lineage for d5fsja_ (5fsj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963611Protein Thermolysin [63414] (3 species)
  7. 2963612Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
    Uniprot P00800
  8. 2963631Domain d5fsja_: 5fsj A: [324420]
    automated match to d1kkka_
    complexed with ca, lys, oxy, val, zn

Details for d5fsja_

PDB Entry: 5fsj (more details), 1.2 Å

PDB Description: structure of thermolysin prepared by the 'soak-and-freeze' method under 45 bar of oxygen pressure
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5fsja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fsja_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5fsja_:

Click to download the PDB-style file with coordinates for d5fsja_.
(The format of our PDB-style files is described here.)

Timeline for d5fsja_: