Lineage for d5dwda_ (5dwd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510138Species Pelagibacterium halotolerans [TaxId:1082931] [324418] (1 PDB entry)
  8. 2510139Domain d5dwda_: 5dwd A: [324419]
    automated match to d3cn9a_
    complexed with 1pg, gol

Details for d5dwda_

PDB Entry: 5dwd (more details), 1.66 Å

PDB Description: crystal structure of esterase pe8
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d5dwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dwda_ c.69.1.0 (A:) automated matches {Pelagibacterium halotolerans [TaxId: 1082931]}
vklsgpmlpavsgaakslvvllhgygsdgrdlialgqfwrdsfpdtmfvapnaphvcggn
pfgyewfpldlerdrtlarlagaetahpvldafladlwaqtglgpadtilvgfsqgamma
lytglrlpeplkaiiafsglivapekleaeiaskppvllihgdlddvvpvigsetalpkl
idlgidarlhisqgsghtiaqdgldtataflreil

SCOPe Domain Coordinates for d5dwda_:

Click to download the PDB-style file with coordinates for d5dwda_.
(The format of our PDB-style files is described here.)

Timeline for d5dwda_: