Lineage for d5fcza2 (5fcz A:151-506)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440644Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2440683Protein beta-N-acetylhexosaminidase [63915] (1 species)
  7. 2440684Species Streptomyces plicatus [TaxId:1922] [63916] (8 PDB entries)
  8. 2440692Domain d5fcza2: 5fcz A:151-506 [324417]
    Other proteins in same PDB: d5fcza1
    automated match to d1jaka1
    complexed with cl, gol, so4, tnx

Details for d5fcza2

PDB Entry: 5fcz (more details), 2.45 Å

PDB Description: streptomyces plicatus n-acetyl-beta-hexosaminidase in complex with thio-naglucal (tnx)
PDB Compounds: (A:) B-N-acetylhexosaminidase

SCOPe Domain Sequences for d5fcza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fcza2 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]}
yawrsamldvsrhffgvdevkryidrvarykynklhlhlsddqgwriaidswprlatygg
stevgggpggyytkaeykeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfsslcvdkdvtydfvddvigelaaltpgrylhiggdeahstpkadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtgdaekaevaeaarngtglilspad
rtyldmkytkdtplglswagyvevqrsydwdpagylpgapadavrgveaplwtetlsdpd
qldymafprlpgvaelgwspasthdwdtykvrlaaqapyweaagidfyrspqvpwt

SCOPe Domain Coordinates for d5fcza2:

Click to download the PDB-style file with coordinates for d5fcza2.
(The format of our PDB-style files is described here.)

Timeline for d5fcza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fcza1