Lineage for d5fcrb_ (5fcr B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406607Species Mouse (Mus musculus) [TaxId:10090] [188816] (5 PDB entries)
  8. 2406609Domain d5fcrb_: 5fcr B: [324415]
    automated match to d4d9qa_
    complexed with dms, epe, gol, so4

Details for d5fcrb_

PDB Entry: 5fcr (more details), 1.25 Å

PDB Description: mouse complement factor d
PDB Compounds: (B:) complement factor d

SCOPe Domain Sequences for d5fcrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fcrb_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ilggqeaaaharpymasvqvngthvcggtlldeqwvlsaahcmdgvtdddsvqvllgahs
lsapepykrwydvqsvvphpgsrpdsleddlilfklsqnaslgphvrplplqyedkevep
gtlcdvagwgvvthagrrpdvlhqlrvsimnrttcnlrtyhdgvvtinmmcaesnrrdtc
rgdsgsplvcgdavegvvtwgsrvcgngkkpgvytrvssyrmwienitng

SCOPe Domain Coordinates for d5fcrb_:

Click to download the PDB-style file with coordinates for d5fcrb_.
(The format of our PDB-style files is described here.)

Timeline for d5fcrb_: