![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188816] (5 PDB entries) |
![]() | Domain d5fcrb_: 5fcr B: [324415] automated match to d4d9qa_ complexed with dms, epe, gol, so4 |
PDB Entry: 5fcr (more details), 1.25 Å
SCOPe Domain Sequences for d5fcrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fcrb_ b.47.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ilggqeaaaharpymasvqvngthvcggtlldeqwvlsaahcmdgvtdddsvqvllgahs lsapepykrwydvqsvvphpgsrpdsleddlilfklsqnaslgphvrplplqyedkevep gtlcdvagwgvvthagrrpdvlhqlrvsimnrttcnlrtyhdgvvtinmmcaesnrrdtc rgdsgsplvcgdavegvvtwgsrvcgngkkpgvytrvssyrmwienitng
Timeline for d5fcrb_: