Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Dengue virus type 3 (strain philippines/h87/1956) [TaxId:408870] [324373] (4 PDB entries) |
Domain d5ec8a1: 5ec8 A:7-256 [324402] Other proteins in same PDB: d5ec8a2, d5ec8c2 automated match to d3elda_ complexed with 5lp, sam |
PDB Entry: 5ec8 (more details), 1.71 Å
SCOPe Domain Sequences for d5ec8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ec8a1 c.66.1.0 (A:7-256) automated matches {Dengue virus type 3 (strain philippines/h87/1956) [TaxId: 408870]} etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth rrptiekdvd
Timeline for d5ec8a1: