Lineage for d5fctb_ (5fct B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212382Protein automated matches [190469] (15 species)
    not a true protein
  7. 2212508Species Mouse (Mus musculus) [TaxId:10090] [225826] (7 PDB entries)
  8. 2212519Domain d5fctb_: 5fct B: [324397]
    automated match to d4eb4a_
    complexed with c2f, ufp

Details for d5fctb_

PDB Entry: 5fct (more details), 1.55 Å

PDB Description: mouse thymidylate synthase in ternary complex with fdump and methylenetetrahydrofolate.
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d5fctb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fctb_ d.117.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

SCOPe Domain Coordinates for d5fctb_:

Click to download the PDB-style file with coordinates for d5fctb_.
(The format of our PDB-style files is described here.)

Timeline for d5fctb_: