Lineage for d5gj4g1 (5gj4 G:49-87)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265381Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2265382Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2265395Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2265396Protein automated matches [324386] (2 species)
    not a true protein
  7. 2265397Species Zika virus (strain mr 766) [TaxId:64320] [324387] (1 PDB entry)
  8. 2265401Domain d5gj4g1: 5gj4 G:49-87 [324388]
    Other proteins in same PDB: d5gj4b_, d5gj4d_, d5gj4f_, d5gj4h_
    automated match to d2ijoa_
    complexed with cl

Details for d5gj4g1

PDB Entry: 5gj4 (more details), 1.84 Å

PDB Description: structure of ns2b-ns3 protease from zika virus caught after self- cleavage
PDB Compounds: (G:) Serine protease subunit NS2B

SCOPe Domain Sequences for d5gj4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gj4g1 g.96.1.0 (G:49-87) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
vdmyieragditwekdaevtgnsprldvaldesgdfslv

SCOPe Domain Coordinates for d5gj4g1:

Click to download the PDB-style file with coordinates for d5gj4g1.
(The format of our PDB-style files is described here.)

Timeline for d5gj4g1: