Lineage for d5eifa1 (5eif A:7-256)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502267Species Dengue virus type 3 [TaxId:408870] [324377] (1 PDB entry)
  8. 2502268Domain d5eifa1: 5eif A:7-256 [324378]
    Other proteins in same PDB: d5eifa2, d5eifc2
    automated match to d3elda_
    complexed with 4m0, sam

Details for d5eifa1

PDB Entry: 5eif (more details), 1.5 Å

PDB Description: dengue 3 ns5 methyltransferase bound to s-adenosyl methionine and fragment nb2c3
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5eifa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eifa1 c.66.1.0 (A:7-256) automated matches {Dengue virus type 3 [TaxId: 408870]}
etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv
ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl
msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym
ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth
rrptiekdvd

SCOPe Domain Coordinates for d5eifa1:

Click to download the PDB-style file with coordinates for d5eifa1.
(The format of our PDB-style files is described here.)

Timeline for d5eifa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5eifa2