![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Dengue virus type 3 (strain philippines/h87/1956) [TaxId:408870] [324373] (4 PDB entries) |
![]() | Domain d5ehia1: 5ehi A:7-256 [324374] Other proteins in same PDB: d5ehia2, d5ehic2 automated match to d3elda_ complexed with 5o3, sam |
PDB Entry: 5ehi (more details), 1.3 Å
SCOPe Domain Sequences for d5ehia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ehia1 c.66.1.0 (A:7-256) automated matches {Dengue virus type 3 (strain philippines/h87/1956) [TaxId: 408870]} etlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwfv ernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivkl msgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpym ptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmth rrptiekdvd
Timeline for d5ehia1: