Lineage for d5e3kb_ (5e3k B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149392Species Toxoplasma gondii [TaxId:508771] [256372] (8 PDB entries)
  8. 2149402Domain d5e3kb_: 5e3k B: [324366]
    automated match to d5eqcb_
    complexed with 5jv, co3, peg, so4

Details for d5e3kb_

PDB Entry: 5e3k (more details), 1.7 Å

PDB Description: crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d5e3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e3kb_ c.67.1.0 (B:) automated matches {Toxoplasma gondii [TaxId: 508771]}
arktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfl
agvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntg
aeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftp
gfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlliv
deiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgst
fggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllna
vevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflave
eerk

SCOPe Domain Coordinates for d5e3kb_:

Click to download the PDB-style file with coordinates for d5e3kb_.
(The format of our PDB-style files is described here.)

Timeline for d5e3kb_: