| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (7 PDB entries) |
| Domain d5bt1c_: 5bt1 C: [324357] automated match to d1id3c_ |
PDB Entry: 5bt1 (more details), 2.62 Å
SCOPe Domain Sequences for d5bt1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bt1c_ a.22.1.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
ktriiprhlqlairnddelnkllgn
Timeline for d5bt1c_: