| Class b: All beta proteins [48724] (177 folds) |
| Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) ![]() |
| Family b.141.1.0: automated matches [227220] (1 protein) not a true family |
| Protein automated matches [226959] (3 species) not a true protein |
| Species Streptomyces sp. [TaxId:1400207] [321774] (2 PDB entries) |
| Domain d5b6ia2: 5b6i A:193-299 [324356] Other proteins in same PDB: d5b6ia1, d5b6ib1 automated match to d1rqpa1 complexed with adn, met |
PDB Entry: 5b6i (more details), 1.95 Å
SCOPe Domain Sequences for d5b6ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6ia2 b.141.1.0 (A:193-299) automated matches {Streptomyces sp. [TaxId: 1400207]}
paveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltp
tfadagaigniafylnsrgylslarnaaslaypynlkaglkvrvear
Timeline for d5b6ia2: