SCOPe 2.08: Domain d5b6ia2: 5b6i A:193-299

Lineage for d5b6ia2 (5b6i A:193-299)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.0: automated matches [227220] (1 protein)
   not a true family

6. Protein automated matches [226959] (4 species)
   not a true protein

7. Species Streptomyces sp. [TaxId:1400207] [321774] (2 PDB entries)

8. Domain d5b6ia2: 5b6i A:193-299 [324356]
   Other proteins in same PDB: d5b6ia1, d5b6ib1
   automated match to d1rqpa1
   complexed with adn, met

Details for d5b6ia2

PDB Entry: 5b6i, 1.95 Å

PDB Description: structure of fluorinase from streptomyces sp. ma37

PDB Compounds: (A:) Fluorinase

SCOPe Domain Sequences for d5b6ia2:

Sequence; same for both SEQRES and ATOM records:

>d5b6ia2 b.141.1.0 (A:193-299) automated matches {Streptomyces sp. [TaxId: 1400207]}
paveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltp
tfadagaigniafylnsrgylslarnaaslaypynlkaglkvrvear

Timeline for d5b6ia2:

• d5b6ia2 first appeared in SCOPe 2.06
  
• d5b6ia2 appears in SCOPe 2.07