SCOPe 2.06: Domain d5b6ia1: 5b6i A:8-192

Lineage for d5b6ia1 (5b6i A:8-192)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)

6. Protein automated matches [254631] (2 species)
   not a true protein

7. Species Streptomyces sp. [TaxId:1400207] [321772] (2 PDB entries)

8. Domain d5b6ia1: 5b6i A:8-192 [324355]
   Other proteins in same PDB: d5b6ia2, d5b6ib2
   automated match to d1rqpa2
   complexed with adn, met

Details for d5b6ia1

PDB Entry: 5b6i, 1.95 Å

PDB Description: structure of fluorinase from streptomyces sp. ma37

PDB Compounds: (A:) Fluorinase

SCOPe Domain Sequences for d5b6ia1:

Sequence; same for both SEQRES and ATOM records:

>d5b6ia1 c.132.1.1 (A:8-192) automated matches {Streptomyces sp. [TaxId: 1400207]}
rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsyiyiapnngll
ttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddsei
vrfhr

Timeline for d5b6ia1:

• d5b6ia1 is new in SCOPe 2.06-stable
  
• d5b6ia1 appears in SCOPe 2.07
  
• d5b6ia1 appears in the current release, SCOPe 2.08