Lineage for d5b6ia1 (5b6i A:8-192)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151631Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2151632Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2151633Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 protein domains)
  6. Protein automated matches [254631] (2 species)
    not a true protein
  7. 2278471Species Streptomyces sp. [TaxId:1400207] [321772] (2 PDB entries)
  8. 2281054Domain d5b6ia1: 5b6i A:8-192 [324355]
    Other proteins in same PDB: d5b6ia2, d5b6ib2
    automated match to d1rqpa2
    complexed with adn, met

Details for d5b6ia1

PDB Entry: 5b6i (more details), 1.95 Å

PDB Description: structure of fluorinase from streptomyces sp. ma37
PDB Compounds: (A:) Fluorinase

SCOPe Domain Sequences for d5b6ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ia1 c.132.1.1 (A:8-192) automated matches {Streptomyces sp. [TaxId: 1400207]}
rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsyiyiapnngll
ttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddsei
vrfhr

SCOPe Domain Coordinates for d5b6ia1:

Click to download the PDB-style file with coordinates for d5b6ia1.
(The format of our PDB-style files is described here.)

Timeline for d5b6ia1:

  • d5b6ia1 appears in periodic updates to SCOPe 2.06 starting on 2016-10-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5b6ia2