![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries) |
![]() | Domain d5b8cf1: 5b8c F:32-146 [324353] Other proteins in same PDB: d5b8ca_, d5b8cb_, d5b8cc2, d5b8cd_, d5b8ce_, d5b8cf2, d5b8cg_, d5b8ch_, d5b8ci2, d5b8cj_, d5b8ck_, d5b8cl2 automated match to d3bikc_ |
PDB Entry: 5b8c (more details), 2.15 Å
SCOPe Domain Sequences for d5b8cf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b8cf1 b.1.1.1 (F:32-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]} wnpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgq dsrfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvte
Timeline for d5b8cf1: