Lineage for d5g1rf_ (5g1r F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112073Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2112253Protein automated matches [190149] (9 species)
    not a true protein
  7. 2112402Species Francisella tularensis [TaxId:263] [324166] (3 PDB entries)
  8. 2112429Domain d5g1rf_: 5g1r F: [324330]
    automated match to d3p2la_
    complexed with act, mpd, mrd

Details for d5g1rf_

PDB Entry: 5g1r (more details), 1.9 Å

PDB Description: open conformation of francisella tularensis clpp at 1.9 a
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d5g1rf_:

Sequence, based on SEQRES records: (download)

>d5g1rf_ c.14.1.1 (F:) automated matches {Francisella tularensis [TaxId: 263]}
nlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiy
fyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqim
ihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeak
ayglidhviesre

Sequence, based on observed residues (ATOM records): (download)

>d5g1rf_ c.14.1.1 (F:) automated matches {Francisella tularensis [TaxId: 263]}
nlvptviektagerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
yglidhviesre

SCOPe Domain Coordinates for d5g1rf_:

Click to download the PDB-style file with coordinates for d5g1rf_.
(The format of our PDB-style files is described here.)

Timeline for d5g1rf_: